PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca27021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 285aa    MW: 31360.2 Da    PI: 8.91
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca27021.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.91.4e-51141431128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.... 95 
                 lppGfrFhPtdeelvv+yLk+kv++++l++ +vi+ vd++k++PwdLp++     ke yfFs+r++ky++g+r+nrat sgyWkatgkdk+++++    
  Dca27021.1  14 LPPGFRFHPTDEELVVQYLKRKVHSSPLPA-SVIPVVDVCKSDPWDLPSS-GDLGKERYFFSTRESKYPNGNRSNRATLSGYWKATGKDKPIVAAprtn 110
                 79****************************.99***************43.4457899***********************************987765 PP

         NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                 ++ +vg+kktLvfy+g+ p+g++tdW+mheyrl
  Dca27021.1 111 RSFVVGMKKTLVFYQGKPPHGSRTDWIMHEYRL 143
                 6666***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-5710181IPR003441NAC domain
PROSITE profilePS5100556.48814181IPR003441NAC domain
PfamPF023658.7E-2815143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010089Biological Processxylem development
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MEKKSFVKNG VLRLPPGFRF HPTDEELVVQ YLKRKVHSSP LPASVIPVVD VCKSDPWDLP  60
SSGDLGKERY FFSTRESKYP NGNRSNRATL SGYWKATGKD KPIVAAPRTN RSFVVGMKKT  120
LVFYQGKPPH GSRTDWIMHE YRLVDHTTTV PSSLKSKEAP TTITTAAAGG GDWVLCRIFL  180
KKRNNAGGKN DKEGEEGVVC EDMDAVTVSV ADTFRVDAPV FYDFLARDRL AVAADLNLPA  240
PCASSSGSSN VTQLSRNENN ESSSSEGHEE SSSYCHSFSS PSTKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-501218213169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00507DAPTransfer from AT5G13180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010682684.11e-122PREDICTED: NAC transcription factor 25-like
SwissprotQ9FY933e-86NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A0J8C5N61e-122A0A0J8C5N6_BETVU; Uncharacterized protein
STRINGPOPTR_0001s13380.11e-97(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.17e-83NAC domain containing protein 83